PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_5A0300CE0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 142aa    MW: 15816.2 Da    PI: 10.3437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_5A0300CE0.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd+llvd+v+   +g+W+  ++  g++R++k+c++rw +yl
  Traes_2DL_5A0300CE0.1 15 KGPWTPEEDKLLVDYVQANAPGNWRMLPKLAGLNRCGKSCRLRWTNYL 62
                           79********************************************97 PP

2Myb_DNA-binding54.72.3e-1768112147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T+eE++ ++++++  G++ W+ Ia+ ++ gRt++++k++w++ 
  Traes_2DL_5A0300CE0.1  68 RGPFTPEEHKSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTN 112
                            89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5911062IPR017930Myb domain
SuperFamilySSF466894.03E-3212109IPR009057Homeodomain-like
SMARTSM007179.5E-131464IPR001005SANT/Myb domain
PfamPF002492.9E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-241669IPR009057Homeodomain-like
CDDcd001677.47E-101762No hitNo description
PROSITE profilePS5129425.96563117IPR017930Myb domain
SMARTSM007175.2E-1567115IPR001005SANT/Myb domain
PfamPF002492.1E-1568113IPR001005SANT/Myb domain
CDDcd001672.18E-1170113No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MGRTPCCESR QGLKKGPWTP EEDKLLVDYV QANAPGNWRM LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGP FTPEEHKSIL QLHAIVGNKW SMIAAQLPGR TDNEIKNYWN TNLKKQLRQA  120
ALVGEKHHSA LASPGASAGA GC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-291311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-138AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581451.19e-85PREDICTED: myb-related protein Myb4-like
SwissprotQ8GWP01e-58MYB39_ARATH; Transcription factor MYB39
TrEMBLW5BUS41e-103W5BUS4_WHEAT; Uncharacterized protein
STRINGMLOC_68698.11e-90(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.13e-64myb domain protein 74
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]